rasa calculation failed

[vecos1990]

I just wish to inquire if anyone is also experiencing this "rasa calculation failed" and if there is a wrap around

[Augustin-Zidek]

Does your input have more than 26 chains or did you use more than one letter chain IDs for any of the entities?

[dailypartita]

i have same error when my input like this:

>HA
QIQLVQSGPELKKPGETVKISCKASGYNFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSANSASLQINNLKTDDTATYFCARKRGDWFAYWGQGTLVTVSA

the sequence id only support one uppercase like "A"? When I use "A1" "A2" or "AB", "HA" its turns error.

[Augustin-Zidek]

i have same error when my input like this:

>HA
QIQLVQSGPELKKPGETVKISCKASGYNFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFAFSLETSANSASLQINNLKTDDTATYFCARKRGDWFAYWGQGTLVTVSA

the sequence id only support one uppercase like "A"? When I use "A1" "A2" or "AB", "HA" its turns error.

Correct, due to the MKDSSP format, only single letter chain names are currently supported in the RASA calculation pipeline. I will try to address this in January 2025.