Having location field in genes

[camilogarciabotero]

Hi all

This package is so great! I was wondering if there is any way to fetch the location out of the gbk.genes field. Currently we can get all the fields that start with the / in the record:

gbk.genes[end]

     CDS             47738..47944
                     /db_xref="GeneID:2703534"
                     /locus_tag="lambdap79"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_597782.1"
                     /translation="MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLE
                     AFRAIEAALVKHDNNMKDYSLVVD"
                     /note="Predicted by GeneMark"

I want to be able to get the location qualifier 47738..47944 encoded later as a UnitRange{Int64} --> 47738:47944. Is this a feature we can have in GenomicAnnotations (or already have)?

Best.

[kdyrhage]

You can use locus(gene).position to extract the position as a UnitRange. I'll consider adding an easier way to extract the position in a later version.

[camilogarciabotero]

Here is another user experimenting this:

https://discourse.julialang.org/t/how-to-get-location-of-sequence-in-genomicannotations/106731

[kdyrhage]

I've added position(gene) as a shorthand for locus(gene).position, and a section in the README about how to access the genomic position of a gene.